PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009587298.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 717aa    MW: 79142.9 Da    PI: 6.5942
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009587298.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.7e-192984156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +++ +++t++q+++Le+ F+++++p++++r +L++ lgL  rq+k+WFqNrR+++k
  XP_009587298.1 29 KKRYHRHTANQIQRLEAIFKECPHPDEKTRLQLSRDLGLAPRQIKFWFQNRRTQMK 84
                    678899***********************************************998 PP

2START180.59.6e-572254502206
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     +a  a++el+++++ +ep+W+ks+    + +n + + ++f+++++       ++ea+r+sgvv+m+   lv  ++d + +W+e ++    ka tl
  XP_009587298.1 225 IAGNAMEELIRLVQTNEPLWMKSAidgkDVLNFQNYDRIFPRANShlknhnVRIEASRDSGVVIMNGLALVDMFMDAN-KWQEFFPtivsKARTL 318
                     67899*********************99999*********999999**9999**************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     evissg      ++lqlm+ elq+lsplvp R  +f+R+++q ++ +w+ivdvS d +q++  ss + ++++lpSg+li++++ng+skvtwvehv
  XP_009587298.1 319 EVISSGvmgsrtSTLQLMYEELQVLSPLVPtRQLYFLRFCQQIEQSSWAIVDVSYDITQENLYSSTSCKVHRLPSGCLIQDMPNGYSKVTWVEHV 413
                     ************************************************************977******************************** PP

                     E--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                     +++++ + h l r l++sgla+ga +wv tlqr cek
  XP_009587298.1 414 EVEEKGIiHRLCRDLIHSGLAFGAERWVGTLQRVCEK 450
                     ***99988***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.17E-191186IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.4E-221488IPR009057Homeodomain-like
PROSITE profilePS5007117.4752686IPR001356Homeobox domain
SMARTSM003891.0E-182790IPR001356Homeobox domain
CDDcd000867.35E-182887No hitNo description
PfamPF000463.7E-172984IPR001356Homeobox domain
PROSITE patternPS0002706184IPR017970Homeobox, conserved site
PROSITE profilePS5084848.911215453IPR002913START domain
SuperFamilySSF559614.12E-34216452No hitNo description
CDDcd088751.68E-115219449No hitNo description
SMARTSM002342.1E-48224450IPR002913START domain
PfamPF018529.8E-49225450IPR002913START domain
SuperFamilySSF559611.14E-22471707No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 717 aa     Download sequence    Send to blast
MEYGSGGGGG GGGTSSGGDD PRDAAERRKK RYHRHTANQI QRLEAIFKEC PHPDEKTRLQ  60
LSRDLGLAPR QIKFWFQNRR TQMKAQHERA DNCALRAEND KIRCENIAIR EALKNVICPS  120
CPPVTEDSYF DEQKLRIENM QLKEELDKVS SIAAKYIGRP ISQLPPVQPI HLSSLDLSMS  180
SFVGHGPNSL DLDLDLLPGS SLTIPSLAFC SLNLSDMDKS LMADIAGNAM EELIRLVQTN  240
EPLWMKSAID GKDVLNFQNY DRIFPRANSH LKNHNVRIEA SRDSGVVIMN GLALVDMFMD  300
ANKWQEFFPT IVSKARTLEV ISSGVMGSRT STLQLMYEEL QVLSPLVPTR QLYFLRFCQQ  360
IEQSSWAIVD VSYDITQENL YSSTSCKVHR LPSGCLIQDM PNGYSKVTWV EHVEVEEKGI  420
IHRLCRDLIH SGLAFGAERW VGTLQRVCEK YACLMVNSNP THDLGGVIPS PEGKRSMMKL  480
AKRMVSNFCA SINPSNGHQW NTISGLNEFE VRATLQKSTD PGQPNGVIIS AATTIWLPVP  540
PQNVFNFFRD ERNRPQWDVL SNQNPVQEVA HIANGSHPGN CISVLRAYNT SQNNMLILQE  600
SCIDSSGALV VYSPVDVPAI NIAMSGEDPT YIPLLPSGFT ISPDGHQLDQ DAASCSSSSN  660
ASTIGGRSGG SLITVVFQIL VSSLPSAKMS PESVNTVNNL IGSTVHQIKA ALNCSTS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-160HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009587298.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLK4BJN50.0K4BJN5_SOLLC; Uncharacterized protein
STRINGSolyc03g098200.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24902351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11